PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100235490011
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family G2-like
Protein Properties Length: 285aa    MW: 31185.7 Da    PI: 4.5711
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100235490011genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like76.82.8e-24110159151
                       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                                   k +++WtpeLH+rFv+aveqL G +kA+P++ilelm++++Lt+++++SHLQ
  Ote100235490011|100235490011 110 KVKVDWTPELHRRFVQAVEQL-GVDKAVPSRILELMGIDCLTRHNIASHLQ 159
                                   5689*****************.***************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.465107166IPR017930Myb domain
SuperFamilySSF466893.76E-15108160IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.2E-22108159IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-23110160IPR006447Myb domain, plants
PfamPF002499.1E-7113159IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MLAVSPLRNP KNEREVEMEG FSIEESEFPD FSGGNLLDSI DFDDLFLGIS DGDVLPDLEM  60
DSEILAEFSA SEEETACKMD EIVGINPSSK EGEKGRKSIS QSKNPPGKRK VKVDWTPELH  120
RRFVQAVEQL GVDKAVPSRI LELMGIDCLT RHNIASHLQV XXXXXXXXXX XXLVFENFET  180
QGTPCFPPPP HLPLTRFPTP PVHGIPPPPA MYKVDQAGVG VPAAKTLPQP PSDVHPSKES  240
VDAAIGDVLT KPWLPLPLGL KPPSVDSVMV ELQRQGIPKV PPSCA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A5e-15107159254ARR10-B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011100244.12e-75PREDICTED: probable transcription factor GLK1
TrEMBLA0A103XTP91e-70A0A103XTP9_CYNCS; Homeodomain-like protein
STRINGPOPTR_0007s01230.12e-60(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA25322356